![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (5 families) ![]() binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
![]() | Family c.25.1.1: Reductases [52344] (4 proteins) |
![]() | Protein cytochrome b5 reductase [52357] (2 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [69450] (3 PDB entries) |
![]() | Domain d1qx4a2: 1qx4 A:154-300 [104625] Other proteins in same PDB: d1qx4a1, d1qx4b1 |
PDB Entry: 1qx4 (more details), 1.8 Å
SCOP Domain Sequences for d1qx4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qx4a2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Rat (Rattus norvegicus)} gkfairadkksnpvvrtvksvgmiaggtgitpmlqviravlkdpndhtvcyllfanqsek dillrpeleelrnehssrfklwytvdkapdawdysqgfvneemirdhlpppgeetlilmc gpppmiqfaclpnlervghpkercftf
Timeline for d1qx4a2: