SCOP 1.69: Domain d1qx4b1: 1qx4 B:33-153

Lineage for d1qx4b1 (1qx4 B:33-153)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein cytochrome b5 reductase [50427] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [69273] (3 PDB entries)

8. Domain d1qx4b1: 1qx4 B:33-153 [104626]
   Other proteins in same PDB: d1qx4a2, d1qx4b2

Details for d1qx4b1

PDB Entry: 1qx4, 1.8 Å

PDB Description: structrue of s127p mutant of cytochrome b5 reductase

SCOP Domain Sequences for d1qx4b1:

Sequence, based on SEQRES records:

>d1qx4b1 b.43.4.2 (B:33-153) cytochrome b5 reductase {Rat (Rattus norvegicus)}
itlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnlvirp
ytpvssdddkgfvdlvvkvyfkethpkfpaggkmpqylenmnigdtiefrgpngllvyqg
k

Sequence, based on observed residues (ATOM records):

>d1qx4b1 b.43.4.2 (B:33-153) cytochrome b5 reductase {Rat (Rattus norvegicus)}
itlenpdikyplrlidkeilshdtrrfrfalpspqhilglpigqhiylstridgnlvirp
ytpvssdddkgfvdlvvkvyfkeaggkmpqylenmnigdtiefrgpngllvyqgk

Timeline for d1qx4b1:

• d1qx4b1 is new in SCOP 1.69
  
• d1qx4b1 appears in SCOP 1.71
  
• d1qx4b1 appears in the current release, SCOPe 2.08