Lineage for d1q9ja1 (1q9j A:1-175)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874558Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2874559Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2874646Family c.43.1.2: NRPS condensation domain (amide synthase) [75229] (2 proteins)
    Pfam PF00668; functional domain of multifunctional enzyme containing tandem repeat of two CAT subunit-like domains
  6. 2874647Protein Polyketide synthase associated protein 5, PapA5 [110593] (1 species)
  7. 2874648Species Mycobacterium tuberculosis [TaxId:1773] [110594] (1 PDB entry)
    Uniprot P96208
  8. 2874649Domain d1q9ja1: 1q9j A:1-175 [104590]

Details for d1q9ja1

PDB Entry: 1q9j (more details), 2.75 Å

PDB Description: structure of polyketide synthase associated protein 5 from mycobacterium tuberculosis
PDB Compounds: (A:) Polyketide synthase associated protein 5

SCOPe Domain Sequences for d1q9ja1:

Sequence, based on SEQRES records: (download)

>d1q9ja1 c.43.1.2 (A:1-175) Polyketide synthase associated protein 5, PapA5 {Mycobacterium tuberculosis [TaxId: 1773]}
mfpgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqs
sdggwnlvaddllhsgicvidgtaatngspsgnaelrldqsvsllhlqlilreggaeltl
ylhhcmadghhgavlvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirk

Sequence, based on observed residues (ATOM records): (download)

>d1q9ja1 c.43.1.2 (A:1-175) Polyketide synthase associated protein 5, PapA5 {Mycobacterium tuberculosis [TaxId: 1773]}
mfpgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqs
sdggwnlvaddllhsgicvidaelrldqsvsllhlqlilreggaeltlylhhcmadghhg
avlvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirk

SCOPe Domain Coordinates for d1q9ja1:

Click to download the PDB-style file with coordinates for d1q9ja1.
(The format of our PDB-style files is described here.)

Timeline for d1q9ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q9ja2