![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
![]() | Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) ![]() |
![]() | Family c.43.1.2: NRPS condensation domain (amide synthase) [75229] (2 proteins) Pfam PF00668; functional domain of multifunctional enzyme containing tandem repeat of two CAT subunit-like domains |
![]() | Protein Polyketide synthase associated protein 5, PapA5 [110593] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [110594] (1 PDB entry) Uniprot P96208 |
![]() | Domain d1q9jb2: 1q9j B:181-418 [104593] |
PDB Entry: 1q9j (more details), 2.75 Å
SCOPe Domain Sequences for d1q9jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q9jb2 c.43.1.2 (B:181-418) Polyketide synthase associated protein 5, PapA5 {Mycobacterium tuberculosis [TaxId: 1773]} aerfmsvmyayeipatetpavlahpglpqavpvtrlwlskqqtsdlmafgrehrlslnav vaaailltewqlrntphvpipyvypvdlrfvlappvapteatnllgaasylaeigpntdi vdlasdivatlradlangviqqsglhfgtafegtppglpplvfctdatsfptmrtppgle iedikgqfycsisvpldlyscavyagqliiehhghiaepgksleairsllctvpseyg
Timeline for d1q9jb2: