PDB entry 1q9j

View 1q9j on RCSB PDB site
Description: Structure of polyketide synthase associated protein 5 from Mycobacterium tuberculosis
Class: ligase
Keywords: POLYKETIDE SYNTHASE ASSOCIATED PROTEIN; CONJUGATING ENZYME PAPA5; Mycobacterium tuberculosis, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, LIGASE
Deposited on 2003-08-25, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.236
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyketide synthase associated protein 5
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PAPA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q9ja1, d1q9ja2
  • Chain 'B':
    Compound: Polyketide synthase associated protein 5
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: PAPA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q9jb1, d1q9jb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q9jA (A:)
    mfpgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqs
    sdggwnlvaddllhsgicvidgtaatngspsgnaelrldqsvsllhlqlilreggaeltl
    ylhhcmadghhgavlvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirkqglsg
    aerfmsvmyayeipatetpavlahpglpqavpvtrlwlskqqtsdlmafgrehrlslnav
    vaaailltewqlrntphvpipyvypvdlrfvlappvapteatnllgaasylaeigpntdi
    vdlasdivatlradlangviqqsglhfgtafegtppglpplvfctdatsfptmrtppgle
    iedikgqfycsisvpldlyscavyagqliiehhghiaepgksleairsllctvpseygwi
    me
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9jA (A:)
    mfpgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqs
    sdggwnlvaddllhsgicvidaelrldqsvsllhlqlilreggaeltlylhhcmadghhg
    avlvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirkaerfmsvmyaypglpqa
    vpvtrlwlskqqtsdlmafgrehrlslnavvaaailltewqlrntphvpipyvypvdlrf
    vlappvapteatnllgaasylaeigpntdivdlasdivatlradlangviqqsglhfgta
    fegtppglpplvfctdatsfptmrtppgleiedikgqfycsisvpldlyscavyagqlii
    ehhghiaepgksleairsllctvpseyg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1q9jB (B:)
    mfpgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqs
    sdggwnlvaddllhsgicvidgtaatngspsgnaelrldqsvsllhlqlilreggaeltl
    ylhhcmadghhgavlvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirkqglsg
    aerfmsvmyayeipatetpavlahpglpqavpvtrlwlskqqtsdlmafgrehrlslnav
    vaaailltewqlrntphvpipyvypvdlrfvlappvapteatnllgaasylaeigpntdi
    vdlasdivatlradlangviqqsglhfgtafegtppglpplvfctdatsfptmrtppgle
    iedikgqfycsisvpldlyscavyagqliiehhghiaepgksleairsllctvpseygwi
    me
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q9jB (B:)
    pgsvirklshseevfaqyevftsmtiqlrgvidvdalsdafdallethpvlashleqssd
    ggwnlvaddllhsgicvidaelrldqsvsllhlqlilreggaeltlylhhcmadghhgav
    lvdelfsrytdavttgdpgpitpqptplsmeavlaqrgirkaerfmsvmyayeipatetp
    avlahpglpqavpvtrlwlskqqtsdlmafgrehrlslnavvaaailltewqlrntphvp
    ipyvypvdlrfvlappvapteatnllgaasylaeigpntdivdlasdivatlradlangv
    iqqsglhfgtafegtppglpplvfctdatsfptmrtppgleiedikgqfycsisvpldly
    scavyagqliiehhghiaepgksleairsllctvpseyg