SCOPe 2.08: Domain d1q1ya1: 1q1y A:1-183

Lineage for d1q1ya1 (1q1y A:1-183)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Staphylococcus aureus [TaxId:1280] [75579] (9 PDB entries)
   Uniprot Q9F4L4

8. Domain d1q1ya1: 1q1y A:1-183 [104480]
   Other proteins in same PDB: d1q1ya2
   complexed with bb2, zn

Details for d1q1ya1

PDB Entry: 1q1y, 1.9 Å

PDB Description: crystal structures of peptide deformylase from staphylococcus aureus complexed with actinonin

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d1q1ya1:

Sequence; same for both SEQRES and ATOM records:

>d1q1ya1 d.167.1.1 (A:1-183) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]}
mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidkdhplqphtda
vev

Timeline for d1q1ya1:

• d1q1ya1 first appeared in SCOP 1.69, called d1q1ya_
  
• d1q1ya1 appears in SCOPe 2.07