Lineage for d1q1ya1 (1q1y A:1-183)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606869Protein Peptide deformylase [56422] (11 species)
  7. 2606975Species Staphylococcus aureus [TaxId:1280] [75579] (8 PDB entries)
    Uniprot Q9F4L4
  8. 2606981Domain d1q1ya1: 1q1y A:1-183 [104480]
    Other proteins in same PDB: d1q1ya2
    complexed with bb2, zn

Details for d1q1ya1

PDB Entry: 1q1y (more details), 1.9 Å

PDB Description: crystal structures of peptide deformylase from staphylococcus aureus complexed with actinonin
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d1q1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q1ya1 d.167.1.1 (A:1-183) Peptide deformylase {Staphylococcus aureus [TaxId: 1280]}
mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidkdhplqphtda
vev

SCOPe Domain Coordinates for d1q1ya1:

Click to download the PDB-style file with coordinates for d1q1ya1.
(The format of our PDB-style files is described here.)

Timeline for d1q1ya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q1ya2