PDB entry 1q1y

View 1q1y on RCSB PDB site
Description: Crystal Structures of Peptide Deformylase from Staphylococcus aureus Complexed with Actinonin
Class: Hydrolase
Keywords: metallo-enzyme, peptide deformylase, actinonin, Staphylococcus aureus, Hydrolase
Deposited on 2003-07-23, released 2004-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SA1100
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68826 (0-182)
      • modified residue (110)
      • see remark 999 (170)
      • expression tag (183-185)
    Domains in SCOPe 2.08: d1q1ya1, d1q1ya2
  • Heterogens: ZN, BB2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1q1yA (A:)
    mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
    laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
    lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidkdhplqphtda
    vevlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1q1yA (A:)
    mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
    laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
    lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidkdhplqphtda
    vevleh