Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) |
Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
Protein Ribonuclease Sa2 [110767] (1 species) |
Species Streptomyces aureofaciens [TaxId:1894] [110768] (2 PDB entries) Uniprot Q53752 |
Domain d1pyla_: 1pyl A: [104391] complexed with so4 |
PDB Entry: 1pyl (more details), 1.51 Å
SCOPe Domain Sequences for d1pyla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pyla_ d.1.1.2 (A:) Ribonuclease Sa2 {Streptomyces aureofaciens [TaxId: 1894]} dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt pgsndrgtrrvvtggygeqywspdhyatfqeidprc
Timeline for d1pyla_: