SCOPe 2.07: Domain d1pyla_: 1pyl A:

Lineage for d1pyla_ (1pyl A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein Ribonuclease Sa2 [110767] (1 species)

7. Species Streptomyces aureofaciens [TaxId:1894] [110768] (2 PDB entries)
   Uniprot Q53752

8. Domain d1pyla_: 1pyl A: [104391]
   complexed with so4

Details for d1pyla_

PDB Entry: 1pyl, 1.51 Å

PDB Description: Crystal structure of Ribonuclease Sa2

PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d1pyla_:

Sequence; same for both SEQRES and ATOM records:

>d1pyla_ d.1.1.2 (A:) Ribonuclease Sa2 {Streptomyces aureofaciens [TaxId: 1894]}
dpaladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvt
pgsndrgtrrvvtggygeqywspdhyatfqeidprc

Timeline for d1pyla_:

• d1pyla_ first appeared in SCOP 1.69
  
• d1pyla_ appears in SCOPe 2.06
  
• d1pyla_ appears in the current release, SCOPe 2.08