![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
![]() | Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) ![]() |
![]() | Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
![]() | Protein Ribonuclease Sa2 [110767] (1 species) |
![]() | Species Streptomyces aureofaciens [TaxId:1894] [110768] (2 PDB entries) Uniprot Q53752 |
![]() | Domain d1pylb_: 1pyl B: [104392] complexed with so4 |
PDB Entry: 1pyl (more details), 1.51 Å
SCOPe Domain Sequences for d1pylb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pylb_ d.1.1.2 (B:) Ribonuclease Sa2 {Streptomyces aureofaciens [TaxId: 1894]} aladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpg sndrgtrrvvtggygeqywspdhyatfqeidprc
Timeline for d1pylb_: