SCOPe 2.06: Domain d1px9a_: 1px9 A:

Lineage for d1px9a_ (1px9 A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.7: Scorpion toxin-like [57095] (6 families)

5. Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)

6. Protein Ergtoxin (HERG specific toxin CnErg1) [90137] (1 species)

7. Species Mexican scorpion (Centruroides noxius) [TaxId:6878] [90138] (2 PDB entries)
   Uniprot Q86QT3 21-62

8. Domain d1px9a_: 1px9 A: [104381]

Details for d1px9a_

PDB Entry: 1px9

PDB Description: solution structure of the native cnerg1 ergtoxin, a highly specific inhibitor of herg channel

PDB Compounds: (A:) ergtoxin

SCOPe Domain Sequences for d1px9a_:

Sequence; same for both SEQRES and ATOM records:

>d1px9a_ g.3.7.2 (A:) Ergtoxin (HERG specific toxin CnErg1) {Mexican scorpion (Centruroides noxius) [TaxId: 6878]}
drdscvdksrcakygyyqecqdccknaghnggtcmffkckca

Timeline for d1px9a_:

• d1px9a_ first appeared in SCOP 1.69
  
• d1px9a_ appears in SCOPe 2.05
  
• d1px9a_ appears in SCOPe 2.07
  
• d1px9a_ appears in the current release, SCOPe 2.08