Lineage for d1px9a_ (1px9 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030456Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 3030578Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 3030629Protein Ergtoxin (HERG specific toxin CnErg1) [90137] (1 species)
  7. 3030630Species Mexican scorpion (Centruroides noxius) [TaxId:6878] [90138] (2 PDB entries)
    Uniprot Q86QT3 21-62
  8. 3030631Domain d1px9a_: 1px9 A: [104381]

Details for d1px9a_

PDB Entry: 1px9 (more details)

PDB Description: solution structure of the native cnerg1 ergtoxin, a highly specific inhibitor of herg channel
PDB Compounds: (A:) ergtoxin

SCOPe Domain Sequences for d1px9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px9a_ g.3.7.2 (A:) Ergtoxin (HERG specific toxin CnErg1) {Mexican scorpion (Centruroides noxius) [TaxId: 6878]}
drdscvdksrcakygyyqecqdccknaghnggtcmffkckca

SCOPe Domain Coordinates for d1px9a_:

Click to download the PDB-style file with coordinates for d1px9a_.
(The format of our PDB-style files is described here.)

Timeline for d1px9a_: