![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) ![]() |
![]() | Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins) |
![]() | Protein Ergtoxin (HERG specific toxin CnErg1) [90137] (1 species) |
![]() | Species Mexican scorpion (Centruroides noxius) [TaxId:6878] [90138] (2 PDB entries) Uniprot Q86QT3 21-62 |
![]() | Domain d1px9a_: 1px9 A: [104381] |
PDB Entry: 1px9 (more details)
SCOPe Domain Sequences for d1px9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px9a_ g.3.7.2 (A:) Ergtoxin (HERG specific toxin CnErg1) {Mexican scorpion (Centruroides noxius) [TaxId: 6878]} drdscvdksrcakygyyqecqdccknaghnggtcmffkckca
Timeline for d1px9a_: