Class b: All beta proteins [48724] (149 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) |
Protein beta-Galactosidase, domain 5 [49996] (1 species) |
Species Escherichia coli [TaxId:562] [49997] (25 PDB entries) |
Domain d1px4d4: 1px4 D:731-1023 [104379] Other proteins in same PDB: d1px4a1, d1px4a2, d1px4a3, d1px4a5, d1px4b1, d1px4b2, d1px4b3, d1px4b5, d1px4c1, d1px4c2, d1px4c3, d1px4c5, d1px4d1, d1px4d2, d1px4d3, d1px4d5 complexed with dms, ipt, mg, na; mutant |
PDB Entry: 1px4 (more details), 1.6 Å
SCOP Domain Sequences for d1px4d4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px4d4 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1px4d4:
View in 3D Domains from same chain: (mouse over for more information) d1px4d1, d1px4d2, d1px4d3, d1px4d5 |