Lineage for d1px4c1 (1px4 C:220-333)
- Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) 
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins) Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species) Species Escherichia coli [TaxId:562] [49306] (25 PDB entries) 
Domain d1px4c1: 1px4 C:220-333 [104371]
Other proteins in same PDB: d1px4a3, d1px4a4, d1px4a5, d1px4b3, d1px4b4, d1px4b5, d1px4c3, d1px4c4, d1px4c5, d1px4d3, d1px4d4, d1px4d5
Details for d1px4c1
PDB Entry: 1px4 (more details), 1.6 Å
PDB Description: e. coli (lacz) beta-galactosidase (g794a) with iptg bound
SCOP Domain Sequences for d1px4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px4c1 b.1.4.1 (C:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr
SCOP Domain Coordinates for d1px4c1:
Click to download the PDB-style file with coordinates for d1px4c1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1px4c1:
- d1px4c1 first appeared in SCOP 1.69
- d1px4c1 appears in SCOP 1.73
- d1px4c1 appears in the current release, SCOPe 2.08
 View in 3DDomains from same chain: (mouse over for more information) d1px4c2, d1px4c3, d1px4c4, d1px4c5 |
