Lineage for d1px4d4 (1px4 D:731-1023)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 460730Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 460800Superfamily b.30.5: Galactose mutarotase-like [74650] (10 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 460801Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
  6. 460802Protein beta-Galactosidase, domain 5 [49996] (1 species)
  7. 460803Species Escherichia coli [TaxId:562] [49997] (25 PDB entries)
  8. 460815Domain d1px4d4: 1px4 D:731-1023 [104379]
    Other proteins in same PDB: d1px4a1, d1px4a2, d1px4a3, d1px4a5, d1px4b1, d1px4b2, d1px4b3, d1px4b5, d1px4c1, d1px4c2, d1px4c3, d1px4c5, d1px4d1, d1px4d2, d1px4d3, d1px4d5

Details for d1px4d4

PDB Entry: 1px4 (more details), 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a) with iptg bound

SCOP Domain Sequences for d1px4d4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px4d4 b.30.5.1 (D:731-1023) beta-Galactosidase, domain 5 {Escherichia coli}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOP Domain Coordinates for d1px4d4:

Click to download the PDB-style file with coordinates for d1px4d4.
(The format of our PDB-style files is described here.)

Timeline for d1px4d4: