Lineage for d1pv3a1 (1pv3 A:920-1053)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988065Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) (S)
  5. 1988066Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 protein domains)
    automatically mapped to Pfam PF03623
  6. 1988067Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 1988068Species Chicken (Gallus gallus) [TaxId:9031] [81735] (3 PDB entries)
    Uniprot Q00944 RE 920-1053
  8. 1988070Domain d1pv3a1: 1pv3 A:920-1053 [104321]
    Other proteins in same PDB: d1pv3a2

Details for d1pv3a1

PDB Entry: 1pv3 (more details)

PDB Description: nmr solution structure of the avian fat-domain of focal adhesion kinase
PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d1pv3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv3a1 a.24.14.1 (A:920-1053) FAT domain of focal adhesion kinase {Chicken (Gallus gallus) [TaxId: 9031]}
rsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdeslpvlpas
threiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaahalavdaknlldvi
dqarlkmisqsrph

SCOPe Domain Coordinates for d1pv3a1:

Click to download the PDB-style file with coordinates for d1pv3a1.
(The format of our PDB-style files is described here.)

Timeline for d1pv3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pv3a2