Lineage for d1pp9r1 (1pp9 R:70-196)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782335Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 2782357Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (4 species)
  7. 2782376Species Cow (Bos taurus) [TaxId:9913] [50025] (20 PDB entries)
  8. 2782383Domain d1pp9r1: 1pp9 R:70-196 [104245]
    Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_
    complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, uq

Details for d1pp9r1

PDB Entry: 1pp9 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (R:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d1pp9r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp9r1 b.33.1.1 (R:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]}
amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
ddmvivg

SCOPe Domain Coordinates for d1pp9r1:

Click to download the PDB-style file with coordinates for d1pp9r1.
(The format of our PDB-style files is described here.)

Timeline for d1pp9r1: