Lineage for d1pp9r2 (1pp9 R:1-69)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578776Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2578777Family f.23.12.1: ISP transmembrane anchor [81501] (2 protein domains)
  6. 2578778Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 2578794Species Cow (Bos taurus) [TaxId:9913] [81497] (18 PDB entries)
    Uniprot P13272; precursor of chains I,E and V,R
  8. 2578801Domain d1pp9r2: 1pp9 R:1-69 [104246]
    Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9j_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_, d1pp9w_
    complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, uq

Details for d1pp9r2

PDB Entry: 1pp9 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (R:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d1pp9r2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp9r2 f.23.12.1 (R:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

SCOPe Domain Coordinates for d1pp9r2:

Click to download the PDB-style file with coordinates for d1pp9r2.
(The format of our PDB-style files is described here.)

Timeline for d1pp9r2: