Lineage for d1pp9j_ (1pp9 J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026015Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 3026016Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 3026017Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 3026028Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries)
    Uniprot P00130
  8. 3026033Domain d1pp9j_: 1pp9 J: [104236]
    Other proteins in same PDB: d1pp9a1, d1pp9a2, d1pp9b1, d1pp9b2, d1pp9c1, d1pp9c2, d1pp9d1, d1pp9d2, d1pp9e1, d1pp9e2, d1pp9f_, d1pp9g_, d1pp9h_, d1pp9i_, d1pp9n1, d1pp9n2, d1pp9o1, d1pp9o2, d1pp9p1, d1pp9p2, d1pp9q1, d1pp9q2, d1pp9r1, d1pp9r2, d1pp9s_, d1pp9t_, d1pp9u_, d1pp9v_
    complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, uq

Details for d1pp9j_

PDB Entry: 1pp9 (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound
PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d1pp9j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp9j_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
nk

SCOPe Domain Coordinates for d1pp9j_:

Click to download the PDB-style file with coordinates for d1pp9j_.
(The format of our PDB-style files is described here.)

Timeline for d1pp9j_: