SCOPe 2.07: Domain d1poka1: 1pok A:1-62,A:347-388

Lineage for d1poka1 (1pok A:1-62,A:347-388)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein)

6. Protein Isoaspartyl dipeptidase [89439] (1 species)

7. Species Escherichia coli [TaxId:562] [89440] (5 PDB entries)
   Uniprot P39377

8. Domain d1poka1: 1pok A:1-62,A:347-388 [104207]
   Other proteins in same PDB: d1poka2, d1pokb2
   complexed with asn, so4, zn

Details for d1poka1

PDB Entry: 1pok, 2.7 Å

PDB Description: crystal structure of isoaspartyl dipeptidase

PDB Compounds: (A:) Isoaspartyl dipeptidase

SCOPe Domain Sequences for d1poka1:

Sequence; same for both SEQRES and ATOM records:

>d1poka1 b.92.1.7 (A:1-62,A:347-388) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]}
midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfe

Timeline for d1poka1:

• d1poka1 first appeared in SCOP 1.69
  
• d1poka1 appears in SCOPe 2.06
  
• d1poka1 appears in the current release, SCOPe 2.08