Lineage for d1poka1 (1pok A:1-62,A:347-388)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819141Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2819142Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2819320Family b.92.1.7: Isoaspartyl dipeptidase [89438] (1 protein)
  6. 2819321Protein Isoaspartyl dipeptidase [89439] (1 species)
  7. 2819322Species Escherichia coli [TaxId:562] [89440] (5 PDB entries)
    Uniprot P39377
  8. 2819331Domain d1poka1: 1pok A:1-62,A:347-388 [104207]
    Other proteins in same PDB: d1poka2, d1pokb2
    complexed with asn, so4, zn

Details for d1poka1

PDB Entry: 1pok (more details), 2.7 Å

PDB Description: crystal structure of isoaspartyl dipeptidase
PDB Compounds: (A:) Isoaspartyl dipeptidase

SCOPe Domain Sequences for d1poka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poka1 b.92.1.7 (A:1-62,A:347-388) Isoaspartyl dipeptidase {Escherichia coli [TaxId: 562]}
midytaagftllqgahlyapedrgicdvlvangkiiavasnipsdivpnctvvdlsgqil
cpXeilpgndadllvmtpelrieqvyargklmvkdgkacvkgtfe

SCOPe Domain Coordinates for d1poka1:

Click to download the PDB-style file with coordinates for d1poka1.
(The format of our PDB-style files is described here.)

Timeline for d1poka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1poka2