SCOPe 2.06: Domain d1pg8d_: 1pg8 D:

Lineage for d1pg8d_ (1pg8 D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)

6. Protein Methionine gamma-lyase, MGL [64126] (4 species)

7. Species Pseudomonas putida [TaxId:303] [75271] (10 PDB entries)
   Uniprot P13254

8. Domain d1pg8d_: 1pg8 D: [104153]
   complexed with peg, plp, so4

Details for d1pg8d_

PDB Entry: 1pg8, 2.68 Å

PDB Description: Crystal Structure of L-methionine alpha-, gamma-lyase

PDB Compounds: (D:) methionine gamma-lyase

SCOPe Domain Sequences for d1pg8d_:

Sequence; same for both SEQRES and ATOM records:

>d1pg8d_ c.67.1.3 (D:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]}
mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys
risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf
lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg
atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk
dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy
tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt
peerahygiseglvrlsvglediddlladvqqalkasa

Timeline for d1pg8d_:

• d1pg8d_ first appeared in SCOP 1.69
  
• d1pg8d_ appears in SCOPe 2.05
  
• d1pg8d_ appears in SCOPe 2.07
  
• d1pg8d_ appears in the current release, SCOPe 2.08