Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein Methionine gamma-lyase, MGL [64126] (4 species) |
Species Pseudomonas putida [TaxId:303] [75271] (15 PDB entries) Uniprot P13254 |
Domain d1pg8d_: 1pg8 D: [104153] complexed with peg, plp, so4 |
PDB Entry: 1pg8 (more details), 2.68 Å
SCOPe Domain Sequences for d1pg8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pg8d_ c.67.1.3 (D:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} mhgsnklpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfys risnptlnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaf lhhgigefgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhg atvvvdntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglk dmtgavlsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqy tlarqqmsqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssyt peerahygiseglvrlsvglediddlladvqqalkasa
Timeline for d1pg8d_: