SCOP 1.69: Domain d1pf0a_: 1pf0 A:

Lineage for d1pf0a_ (1pf0 A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (6 proteins)
   Pfam 00027

6. Protein Putative ion channel CnbD [110321] (1 species)

7. Species Mesorhizobium loti [TaxId:381] [110322] (1 PDB entry)

8. Domain d1pf0a_: 1pf0 A: [104140]

Details for d1pf0a_

PDB Entry: 1pf0, 1.7 Å

PDB Description: M. loti Ion Channel Cylic Nucleotide Binding Domain

SCOP Domain Sequences for d1pf0a_:

Sequence; same for both SEQRES and ATOM records:

>d1pf0a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti}
vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
aeifrktalerrg

Timeline for d1pf0a_:

• d1pf0a_ is new in SCOP 1.69
  
• d1pf0a_ does not appear in SCOP 1.71