PDB entry 1pf0

View 1pf0 on RCSB PDB site
Description: M. loti Ion Channel Cylic Nucleotide Binding Domain
Deposited on 2003-05-23, released 2004-09-28
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.19
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1pf0a_
  • Chain 'C':
    Domains in SCOP 1.69: d1pf0c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pf0A (A:)
    vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
    gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
    aeifrktalerrgaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pf0A (A:)
    vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
    gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
    aeifrktalerrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pf0C (C:)
    vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
    gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
    aeifrktalerrgaaasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pf0C (C:)
    vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
    gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
    aeifrktalerrg