Lineage for d1pf0c_ (1pf0 C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 470925Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 470931Family b.82.3.2: cAMP-binding domain [51210] (6 proteins)
    Pfam 00027
  6. 470967Protein Putative ion channel CnbD [110321] (1 species)
  7. 470968Species Mesorhizobium loti [TaxId:381] [110322] (1 PDB entry)
  8. 470970Domain d1pf0c_: 1pf0 C: [104141]

Details for d1pf0c_

PDB Entry: 1pf0 (more details), 1.7 Å

PDB Description: M. loti Ion Channel Cylic Nucleotide Binding Domain

SCOP Domain Sequences for d1pf0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf0c_ b.82.3.2 (C:) Putative ion channel CnbD {Mesorhizobium loti}
vrrgdfvrnwqlvaavplfqklgpavlveivralrartvpagavicrigepgdrmffvve
gsvsvatpnpvelgpgaffgemalisgeprsatvsaattvsllslhsadfqmlcssspei
aeifrktalerrg

SCOP Domain Coordinates for d1pf0c_:

Click to download the PDB-style file with coordinates for d1pf0c_.
(The format of our PDB-style files is described here.)

Timeline for d1pf0c_:

  • d1pf0c_ is new in SCOP 1.69
  • d1pf0c_ does not appear in SCOP 1.71

View in 3D
Domains from other chains:
(mouse over for more information)
d1pf0a_