Lineage for d1peya_ (1pey A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855425Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2855650Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 2855651Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries)
    Uniprot P06628
  8. 2855655Domain d1peya_: 1pey A: [104137]
    complexed with mn

Details for d1peya_

PDB Entry: 1pey (more details), 2.25 Å

PDB Description: crystal structure of the response regulator spo0f complexed with mn2+
PDB Compounds: (A:) sporulation initiation phosphotransferase f

SCOPe Domain Sequences for d1peya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

SCOPe Domain Coordinates for d1peya_:

Click to download the PDB-style file with coordinates for d1peya_.
(The format of our PDB-style files is described here.)

Timeline for d1peya_: