| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (26 proteins) |
| Protein Sporulation response regulator Spo0F [52188] (1 species) |
| Species Bacillus subtilis [TaxId:1423] [52189] (12 PDB entries) Uniprot P06628 |
| Domain d1peyc_: 1pey C: [104139] complexed with mn |
PDB Entry: 1pey (more details), 2.25 Å
SCOPe Domain Sequences for d1peyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1peyc_ c.23.1.1 (C:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}
mnekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmd
gieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
Timeline for d1peyc_: