Lineage for d1peya_ (1pey A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481070Superfamily c.23.1: CheY-like [52172] (5 families) (S)
  5. 481071Family c.23.1.1: CheY-related [52173] (17 proteins)
  6. 481216Protein Sporulation response regulator Spo0F [52188] (1 species)
  7. 481217Species Bacillus subtilis [TaxId:1423] [52189] (7 PDB entries)
  8. 481219Domain d1peya_: 1pey A: [104137]

Details for d1peya_

PDB Entry: 1pey (more details), 2.25 Å

PDB Description: crystal structure of the response regulator spo0f complexed with mn2+

SCOP Domain Sequences for d1peya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis}
nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl

SCOP Domain Coordinates for d1peya_:

Click to download the PDB-style file with coordinates for d1peya_.
(The format of our PDB-style files is described here.)

Timeline for d1peya_: