| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily) multihelical consists of two all-alpha subdomains subdomain 1 (residues 10-100) is a 4-helical bundle |
Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family) ![]() |
| Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein) |
| Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species) |
| Species Salmonella typhimurium [TaxId:90371] [109946] (5 PDB entries) |
| Domain d1peua1: 1peu A:13-174 [104133] Other proteins in same PDB: d1peua2 complexed with dtp, mg |
PDB Entry: 1peu (more details), 3.2 Å
SCOPe Domain Sequences for d1peua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1peua1 a.98.1.1 (A:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy
ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm
valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge
Timeline for d1peua1: