SCOPe 2.05: Domain d1peua1: 1peu A:13-174

Lineage for d1peua1 (1peu A:13-174)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.98: R1 subunit of ribonucleotide reductase, N-terminal domain [48167] (1 superfamily)
   multihelical consists of two all-alpha subdomains
   subdomain 1 (residues 10-100) is a 4-helical bundle

4. Superfamily a.98.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48168] (1 family)

5. Family a.98.1.1: R1 subunit of ribonucleotide reductase, N-terminal domain [48169] (1 protein)

6. Protein R1 subunit of ribonucleotide reductase, N-terminal domain [48170] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [109946] (5 PDB entries)

8. Domain d1peua1: 1peu A:13-174 [104133]
   Other proteins in same PDB: d1peua2
   complexed with dtp, mg

Details for d1peua1

PDB Entry: 1peu, 3.2 Å

PDB Description: Ribonucleotide Reductase Protein R1E from Salmonella typhimurium

PDB Compounds: (A:) Ribonucleoside-diphosphate reductase 2 alpha chain

SCOPe Domain Sequences for d1peua1:

Sequence; same for both SEQRES and ATOM records:

>d1peua1 a.98.1.1 (A:13-174) R1 subunit of ribonucleotide reductase, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
tmdyhalnamlnlydkaghiqfdkdqqaidaffathvrphsvtfasqherlgtlvregyy
ddavlarydrafvlrlfehahasgfrfqtflgawkfytsytlktfdgkrylehfedrvtm
valtlaqgdetlatqltdemlsgrfqpatptflncgkqqrge

Timeline for d1peua1:

• d1peua1 first appeared in SCOP 1.69
  
• d1peua1 appears in SCOPe 2.04
  
• d1peua1 appears in SCOPe 2.06
  
• d1peua1 appears in the current release, SCOPe 2.08