SCOPe 2.08: Domain d1pc3b_: 1pc3 B:

Lineage for d1pc3b_ (1pc3 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein Phosphate-binding protein [53860] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110747] (1 PDB entry)
   Uniprot P15712

8. Domain d1pc3b_: 1pc3 B: [104103]
   complexed with po4

Details for d1pc3b_

PDB Entry: 1pc3, 2.16 Å

PDB Description: Crystal structure of the extracellular phosphate ABC transport receptor (PstS-1) and immunodominant antigen of M. tuberculosis.

PDB Compounds: (B:) Phosphate-binding protein 1

SCOPe Domain Sequences for d1pc3b_:

Sequence; same for both SEQRES and ATOM records:

>d1pc3b_ c.94.1.1 (B:) Phosphate-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
vattpasspvtlaetgstllyplfnlwgpafherypnvtitaqgtgsgagiaqaaagtvn
igasdaylsegdmaahkglmnialaisaqqvnynlpgvsehlklngkvlaamyqgtiktw
ddpqiaalnpgvnlpgtavvplhrsdgsgdtflftqylskqdpegwgkspgfgttvdfpa
vpgalgengnggmvtgcaetpgcvayigisfldqasqrglgeaqlgnssgnfllpdaqsi
qaaaagfasktpanqaismidgpapdgypiinyeyaivnnrqkdaataqtlqaflhwait
dgnkasfldqvhfqplppavvklsdaliatiss

Timeline for d1pc3b_:

• d1pc3b_ first appeared in SCOP 1.69
  
• d1pc3b_ appears in SCOPe 2.07