Lineage for d1pc3b_ (1pc3 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914577Protein Phosphate-binding protein [53860] (4 species)
  7. 2914593Species Mycobacterium tuberculosis [TaxId:1773] [110747] (1 PDB entry)
    Uniprot P15712
  8. 2914595Domain d1pc3b_: 1pc3 B: [104103]
    complexed with po4

Details for d1pc3b_

PDB Entry: 1pc3 (more details), 2.16 Å

PDB Description: Crystal structure of the extracellular phosphate ABC transport receptor (PstS-1) and immunodominant antigen of M. tuberculosis.
PDB Compounds: (B:) Phosphate-binding protein 1

SCOPe Domain Sequences for d1pc3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pc3b_ c.94.1.1 (B:) Phosphate-binding protein {Mycobacterium tuberculosis [TaxId: 1773]}
vattpasspvtlaetgstllyplfnlwgpafherypnvtitaqgtgsgagiaqaaagtvn
igasdaylsegdmaahkglmnialaisaqqvnynlpgvsehlklngkvlaamyqgtiktw
ddpqiaalnpgvnlpgtavvplhrsdgsgdtflftqylskqdpegwgkspgfgttvdfpa
vpgalgengnggmvtgcaetpgcvayigisfldqasqrglgeaqlgnssgnfllpdaqsi
qaaaagfasktpanqaismidgpapdgypiinyeyaivnnrqkdaataqtlqaflhwait
dgnkasfldqvhfqplppavvklsdaliatiss

SCOPe Domain Coordinates for d1pc3b_:

Click to download the PDB-style file with coordinates for d1pc3b_.
(The format of our PDB-style files is described here.)

Timeline for d1pc3b_: