![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (28 proteins) |
![]() | Protein Phosphate-binding protein [53860] (2 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [110747] (1 PDB entry) |
![]() | Domain d1pc3b_: 1pc3 B: [104103] |
PDB Entry: 1pc3 (more details), 2.16 Å
SCOP Domain Sequences for d1pc3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pc3b_ c.94.1.1 (B:) Phosphate-binding protein {Mycobacterium tuberculosis} vattpasspvtlaetgstllyplfnlwgpafherypnvtitaqgtgsgagiaqaaagtvn igasdaylsegdmaahkglmnialaisaqqvnynlpgvsehlklngkvlaamyqgtiktw ddpqiaalnpgvnlpgtavvplhrsdgsgdtflftqylskqdpegwgkspgfgttvdfpa vpgalgengnggmvtgcaetpgcvayigisfldqasqrglgeaqlgnssgnfllpdaqsi qaaaagfasktpanqaismidgpapdgypiinyeyaivnnrqkdaataqtlqaflhwait dgnkasfldqvhfqplppavvklsdaliatiss
Timeline for d1pc3b_: