Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) the N-terminal domains of these repressors bind DNA |
Family b.34.1.2: Iron-dependent regulator [50041] (2 proteins) |
Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [50043] (14 PDB entries) |
Domain d1p92a3: 1p92 A:148-226 [104087] Other proteins in same PDB: d1p92a1, d1p92a2 complexed with bme; mutant |
PDB Entry: 1p92 (more details), 2.1 Å
SCOP Domain Sequences for d1p92a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p92a3 b.34.1.2 (A:148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn gkdvellddlahtirieel
Timeline for d1p92a3: