Lineage for d1p92a3 (1p92 A:148-226)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461193Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 461194Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 461202Family b.34.1.2: Iron-dependent regulator [50041] (2 proteins)
  6. 461203Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 461204Species Corynebacterium diphtheriae [TaxId:1717] [50043] (13 PDB entries)
  8. 461209Domain d1p92a3: 1p92 A:148-226 [104087]
    Other proteins in same PDB: d1p92a1, d1p92a2

Details for d1p92a3

PDB Entry: 1p92 (more details), 2.1 Å

PDB Description: crystal structure of (h79a)dtxr

SCOP Domain Sequences for d1p92a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p92a3 b.34.1.2 (A:148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirieel

SCOP Domain Coordinates for d1p92a3:

Click to download the PDB-style file with coordinates for d1p92a3.
(The format of our PDB-style files is described here.)

Timeline for d1p92a3: