SCOP 1.69: Domain d1p7oc_: 1p7o C:

Lineage for d1p7oc_ (1p7o C:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Small-eye snake (Micropechis ikaheka), different isoforms [TaxId:66188] [110033] (2 PDB entries)

8. Domain d1p7oc_: 1p7o C: [104078]

Details for d1p7oc_

PDB Entry: 1p7o, 2.3 Å

PDB Description: Crystal structure of phospholipase A2 (MIPLA4) from Micropechis ikaheka

SCOP Domain Sequences for d1p7oc_:

Sequence; same for both SEQRES and ATOM records:

>d1p7oc_ a.133.1.2 (C:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms}
nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
qlck

Timeline for d1p7oc_:

• d1p7oc_ is new in SCOP 1.69
  
• d1p7oc_ appears in SCOP 1.71
  
• d1p7oc_ appears in the current release, SCOPe 2.08