Lineage for d1p7of_ (1p7o F:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 449032Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 449033Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) (S)
  5. 449038Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)
  6. 449118Protein Snake phospholipase A2 [48624] (35 species)
  7. 449253Species Small-eye snake (Micropechis ikaheka), different isoforms [TaxId:66188] [110033] (2 PDB entries)
  8. 449259Domain d1p7of_: 1p7o F: [104081]

Details for d1p7of_

PDB Entry: 1p7o (more details), 2.3 Å

PDB Description: Crystal structure of phospholipase A2 (MIPLA4) from Micropechis ikaheka

SCOP Domain Sequences for d1p7of_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7of_ a.133.1.2 (F:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms}
nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe
ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr
qlck

SCOP Domain Coordinates for d1p7of_:

Click to download the PDB-style file with coordinates for d1p7of_.
(The format of our PDB-style files is described here.)

Timeline for d1p7of_: