Class a: All alpha proteins [46456] (218 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins) |
Protein Snake phospholipase A2 [48624] (35 species) |
Species Small-eye snake (Micropechis ikaheka), different isoforms [TaxId:66188] [110033] (2 PDB entries) |
Domain d1p7of_: 1p7o F: [104081] |
PDB Entry: 1p7o (more details), 2.3 Å
SCOP Domain Sequences for d1p7of_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p7of_ a.133.1.2 (F:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms} nllqfrnmikctipgrepllafsnygcycgkggsgtpvdeldrccqthdncydkaeklpe ckgilsgpyfntysydctdgkltcndqndkcklficncdrtaamcfakapyneaynhfnr qlck
Timeline for d1p7of_: