Lineage for d1oxga_ (1oxg A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
    Uniprot P00766
  8. Domain d1oxga_: 1oxg A: [104044]
    complexed with so4

Details for d1oxga_

PDB Entry: 1oxg (more details), 2.2 Å

PDB Description: Crystal structure of a complex formed between organic solvent treated bovine alpha-chymotrypsin and its autocatalytically produced highly potent 14-residue peptide at 2.2 resolution
PDB Compounds: (A:) chymotrypsinogen a

SCOPe Domain Sequences for d1oxga_:

Sequence, based on SEQRES records: (download)

>d1oxga_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d1oxga_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtt
sdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavc
lpsasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

SCOPe Domain Coordinates for d1oxga_ are not available.

Timeline for d1oxga_: