PDB entry 1oxg

View 1oxg on RCSB PDB site
Description: Crystal structure of a complex formed between organic solvent treated bovine alpha-chymotrypsin and its autocatalytically produced highly potent 14-residue peptide at 2.2 resolution
Class: hydrolase
Keywords: Autocatalysis, Organic solvent treatment, Inhibition, HYDROLASE
Deposited on 2003-04-02, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.192
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1oxga_
  • Chain 'B':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oxgA (A:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oxgA (A:)
    cgvpaiqpvlsglivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtt
    sdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavc
    lpsasddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicag
    asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
    n
    

  • Chain 'B':
    No sequence available.