Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species) secreted during involution |
Species Cow (Bos taurus) [TaxId:9913] [110872] (1 PDB entry) Uniprot P30922 |
Domain d1owqa2: 1owq A:240-307 [104042] Other proteins in same PDB: d1owqa1 complexed with nag |
PDB Entry: 1owq (more details), 2 Å
SCOP Domain Sequences for d1owqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1owqa2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Cow (Bos taurus) [TaxId: 9913]} fgrsytlassktdvgapisgpgipgqftkekgtlayyeicdflhgatthrfrdqqvpyat kgnqwvay
Timeline for d1owqa2: