Lineage for d1owqa1 (1owq A:1-239,A:308-361)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816441Family c.1.8.5: Type II chitinase [51534] (14 proteins)
    glycosylase family 18
  6. 816611Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 816616Species Cow (Bos taurus) [TaxId:9913] [110352] (1 PDB entry)
    Uniprot P30922
  8. 816617Domain d1owqa1: 1owq A:1-239,A:308-361 [104041]
    Other proteins in same PDB: d1owqa2
    complexed with nag

Details for d1owqa1

PDB Entry: 1owq (more details), 2 Å

PDB Description: crystal structure of a 40 kda signalling protein (spc-40) secreted during involution
PDB Compounds: (A:) signal processing protein

SCOP Domain Sequences for d1owqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owqa1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Cow (Bos taurus) [TaxId: 9913]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnfgserfskiasktqsrrtfiksvppflrthgfdgldlawly
pgwrdkrhlttlvkemkaefvreaqagteqlllsaavpagkiaidrgydiaqisrhldfi
slltydfhggwrgtvghhsplfrgnsdgssrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsaikdvlar

SCOP Domain Coordinates for d1owqa1:

Click to download the PDB-style file with coordinates for d1owqa1.
(The format of our PDB-style files is described here.)

Timeline for d1owqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1owqa2