SCOPe 2.01: Domain d1owqa2: 1owq A:240-307

Lineage for d1owqa2 (1owq A:240-307)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Cow (Bos taurus) [TaxId:9913] [110872] (1 PDB entry)
   Uniprot P30922

8. Domain d1owqa2: 1owq A:240-307 [104042]
   Other proteins in same PDB: d1owqa1

Details for d1owqa2

PDB Entry: 1owq, 2 Å

PDB Description: crystal structure of a 40 kda signalling protein (spc-40) secreted during involution

PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d1owqa2:

Sequence; same for both SEQRES and ATOM records:

>d1owqa2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Cow (Bos taurus) [TaxId: 9913]}
fgrsytlassktdvgapisgpgipgqftkekgtlayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d1owqa2:

• d1owqa2 first appeared in SCOP 1.69
  
• d1owqa2 appears in SCOP 1.75
  
• d1owqa2 appears in SCOPe 2.02
  
• d1owqa2 appears in the current release, SCOPe 2.08