Class a: All alpha proteins [46456] (289 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) |
Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins) |
Protein Supernatant protein factor (SPF), N-terminal domain [101071] (1 species) Sec14-like protein 2; contains extra C-terminal beta-sandwich domain |
Species Human (Homo sapiens) [TaxId:9606] [101072] (2 PDB entries) Uniprot O76054 |
Domain d1olme1: 1olm E:1-75 [104014] Other proteins in same PDB: d1olma2, d1olma3, d1olmc2, d1olmc3, d1olme2, d1olme3 complexed with vtq |
PDB Entry: 1olm (more details), 1.95 Å
SCOPe Domain Sequences for d1olme1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1olme1 a.5.3.1 (E:1-75) Supernatant protein factor (SPF), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} msgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlrkhv efrkqkdidniiswq
Timeline for d1olme1: