Lineage for d1olme1 (1olm E:1-75)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 439425Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 439499Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (1 family) (S)
  5. 439500Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins)
  6. 439510Protein Supernatant protein factor (SPF), N-terminal domain [101071] (1 species)
    Sec14-like protein 2; contains extra C-terminal beta-sandwich domain
  7. 439511Species Human (Homo sapiens) [TaxId:9606] [101072] (2 PDB entries)
  8. 439514Domain d1olme1: 1olm E:1-75 [104014]
    Other proteins in same PDB: d1olma2, d1olma3, d1olmc2, d1olmc3, d1olme2, d1olme3

Details for d1olme1

PDB Entry: 1olm (more details), 1.95 Å

PDB Description: supernatant protein factor in complex with rrr-alpha-tocopherylquinone: a link between oxidized vitamin e and cholesterol biosynthesis

SCOP Domain Sequences for d1olme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olme1 a.5.3.1 (E:1-75) Supernatant protein factor (SPF), N-terminal domain {Human (Homo sapiens)}
msgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlrkhv
efrkqkdidniiswq

SCOP Domain Coordinates for d1olme1:

Click to download the PDB-style file with coordinates for d1olme1.
(The format of our PDB-style files is described here.)

Timeline for d1olme1: