SCOPe 2.08: Domain d1j2gb1: 1j2g B:7-158

Lineage for d1j2gb1 (1j2g B:7-158)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein Urate oxidase (uricase) [55634] (3 species)
   duplication: one subunit consists of two domains of this fold; beta-sheets of two subunits form a barrel, closed: n=16, S=16

7. Species Bacillus sp., strain TB-90 [TaxId:1409] [111089] (1 PDB entry)
   Uniprot Q45697 177-482

8. Domain d1j2gb1: 1j2g B:7-158 [103829]
   complexed with aza, so4

Details for d1j2gb1

PDB Entry: 1j2g, 2.2 Å

PDB Description: Crystal structure of Urate oxidase from Bacillus SP. TB-90 co-crystallized with 8-Azaxanthine

PDB Compounds: (B:) Uricase

SCOPe Domain Sequences for d1j2gb1:

Sequence; same for both SEQRES and ATOM records:

>d1j2gb1 d.96.1.4 (B:7-158) Urate oxidase (uricase) {Bacillus sp., strain TB-90 [TaxId: 1409]}
rvmyygkgdvfayrtylkpltgvrtipespfsgrdhilfgvnvkisvggtklltsftkgd
nslvvatdsmknfiqkhlasytgttiegfleyvatsflkkyshiekisligeeipfettf
avkngnraaselvfkksrneyataylnmvrne

Timeline for d1j2gb1:

• d1j2gb1 first appeared in SCOP 1.69
  
• d1j2gb1 appears in SCOPe 2.07