| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.119: DAK1/DegV-like [82548] (1 superfamily) 2 different domains; d1: [core: 3 layers, a/b/a; parallel sheet of 5 strands, order: 2134]; D2: [2 layers, a/b; mixed sheet of 6 strands, order 321645; strands 2 and 6 are antiparallel to the rest] |
Superfamily c.119.1: DAK1/DegV-like [82549] (3 families) ![]() domain folds and architecture show some similarity to the tubulin-like GTPases; the nucleotide-binding sites of the Dihydroxyacetone kinase and tubulin families are different |
| Family c.119.1.2: DAK1 [109613] (3 proteins) Pfam PF02733 |
| Protein Dihydroxyacetone kinase [109616] (1 species) contains additional alpha-helical, ATP-binding domain |
| Species Citrobacter freundii [TaxId:546] [109617] (2 PDB entries) |
| Domain d1un8a4: 1un8 A:1-335 [103806] Other proteins in same PDB: d1un8a1, d1un8b1 complexed with myy |
PDB Entry: 1un8 (more details), 2.5 Å
SCOPe Domain Sequences for d1un8a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1un8a4 c.119.1.2 (A:1-335) Dihydroxyacetone kinase {Citrobacter freundii [TaxId: 546]}
msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
kgfsltaivleesiekalltevetsnwptpvppre
Timeline for d1un8a4: