Lineage for d1un8a1 (1un8 A:336-550)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014785Fold a.208: DhaL-like [101472] (1 superfamily)
    multihelical; bundle
  4. 2014786Superfamily a.208.1: DhaL-like [101473] (2 families) (S)
  5. 2014787Family a.208.1.1: DhaL-like [101474] (2 protein domains)
    automatically mapped to Pfam PF02734
  6. 2014788Protein Citrobacter dihydroxyacetone kinase extra ATP-binding domain [101475] (1 species)
    eight-helical up-and-down barrel with a central ligand-binding cavity
  7. 2014789Species Citrobacter freundii [TaxId:546] [101476] (2 PDB entries)
  8. 2014790Domain d1un8a1: 1un8 A:336-550 [99661]
    Other proteins in same PDB: d1un8a4, d1un8b4
    complexed with myy

Details for d1un8a1

PDB Entry: 1un8 (more details), 2.5 Å

PDB Description: crystal structure of the dihydroxyacetone kinase of c. freundii (native form)
PDB Compounds: (A:) dihydroxyacetone kinase

SCOPe Domain Sequences for d1un8a1:

Sequence, based on SEQRES records: (download)

>d1un8a1 a.208.1.1 (A:336-550) Citrobacter dihydroxyacetone kinase extra ATP-binding domain {Citrobacter freundii [TaxId: 546]}
itcvvsshasarvefqpsanalvagivelvtatlsdlethlnaldakvgdgdtgstfaaa
areiasllhrqqlplnnlatlfaligerltvvmggssgvlmsifftaagqkleqganvve
alntglaqmkfyggadegdrtmidalqpaltsllaqpknlqaafdaaqagaertclsska
nagrasylssesllgnmdpgaqrlamvfkalaese

Sequence, based on observed residues (ATOM records): (download)

>d1un8a1 a.208.1.1 (A:336-550) Citrobacter dihydroxyacetone kinase extra ATP-binding domain {Citrobacter freundii [TaxId: 546]}
itcvvsshasarvefqpsanalvagivelvtatlsdlethlnaldakvgdgdtgstfaaa
areiasllhrqqlplnnlatlfaligerltvvmggssgvlmsifftaagqkleqganvve
alntglaqmkfyggadegdrtmidalqpaltsllaqpknlqaafdaaqagaertclsska
naesllgnmdpgaqrlamvfkalaese

SCOPe Domain Coordinates for d1un8a1:

Click to download the PDB-style file with coordinates for d1un8a1.
(The format of our PDB-style files is described here.)

Timeline for d1un8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1un8a4