PDB entry 1un8

View 1un8 on RCSB PDB site
Description: crystal structure of the dihydroxyacetone kinase of c. freundii (native form)
Class: transferase
Keywords: transferase
Deposited on 2003-09-08, released 2003-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroxyacetone kinase
    Species: Citrobacter freundii [TaxId:546]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1un8a1, d1un8a4
  • Chain 'B':
    Compound: dihydroxyacetone kinase
    Species: Citrobacter freundii [TaxId:546]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1un8b1, d1un8b4
  • Heterogens: MYY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1un8A (A:)
    msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
    hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
    aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
    yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
    vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
    kgfsltaivleesiekalltevetsnwptpvppreitcvvsshasarvefqpsanalvag
    ivelvtatlsdlethlnaldakvgdgdtgstfaaaareiasllhrqqlplnnlatlfali
    gerltvvmggssgvlmsifftaagqkleqganvvealntglaqmkfyggadegdrtmida
    lqpaltsllaqpknlqaafdaaqagaertclsskanagrasylssesllgnmdpgaqrla
    mvfkalaeselg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un8A (A:)
    msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
    hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
    aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
    yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
    vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
    kgfsltaivleesiekalltevetsnwptpvppreitcvvsshasarvefqpsanalvag
    ivelvtatlsdlethlnaldakvgdgdtgstfaaaareiasllhrqqlplnnlatlfali
    gerltvvmggssgvlmsifftaagqkleqganvvealntglaqmkfyggadegdrtmida
    lqpaltsllaqpknlqaafdaaqagaertclsskanaesllgnmdpgaqrlamvfkalae
    se
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1un8B (B:)
    msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
    hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
    aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
    yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
    vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
    kgfsltaivleesiekalltevetsnwptpvppreitcvvsshasarvefqpsanalvag
    ivelvtatlsdlethlnaldakvgdgdtgstfaaaareiasllhrqqlplnnlatlfali
    gerltvvmggssgvlmsifftaagqkleqganvvealntglaqmkfyggadegdrtmida
    lqpaltsllaqpknlqaafdaaqagaertclsskanagrasylssesllgnmdpgaqrla
    mvfkalaeselg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1un8B (B:)
    msqfffnqrthlvsdvidgaiiaspwnnlarlesdpairivvrrdlnknnvavisgggsg
    hepahvgfigkgmltaavcgdvfaspsvdavltaiqavtgeagcllivknytgdrlnfgl
    aaekarrlgynvemlivgddislpdnkhprgiagtilvhkiagyfaergynlatvlreaq
    yaasntfslgvalsschlpqetdaaprhhpghaelgmgihgepgasvidtqnsaqvvnlm
    vdkllaalpetgrlavminnlggvsvaemaiitrelassplhsridwligpaslvtaldm
    kgfsltaivleesiekalltevetsnwptpvppreitcvvsshasarvefqpsanalvag
    ivelvtatlsdlethlnaldakvgdgdtgstfaaaareiasllhrqqlplnnlatlfali
    gerltvvmggssgvlmsifftaagqkleqganvvealntglaqmkfyggadegdrtmida
    lqpaltsllaqpknlqaafdaaqagaertclsskanaesllgnmdpgaqrlamvfkalae
    se