Lineage for d1vjta2 (1vjt A:182-469)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999460Family d.162.1.2: AglA-like glucosidase [90050] (5 proteins)
    family 4 glycosyl hydrolase
    automatically mapped to Pfam PF11975
  6. 2999497Protein Putative alpha-glucosidase TM0752 [103327] (1 species)
  7. 2999498Species Thermotoga maritima [TaxId:2336] [103328] (1 PDB entry)
  8. 2999499Domain d1vjta2: 1vjt A:182-469 [100834]
    Other proteins in same PDB: d1vjta1, d1vjta3
    structural genomics
    complexed with nad

Details for d1vjta2

PDB Entry: 1vjt (more details), 2.5 Å

PDB Description: Crystal structure of Alpha-glucosidase (TM0752) from Thermotoga maritima at 2.50 A resolution
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d1vjta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjta2 d.162.1.2 (A:182-469) Putative alpha-glucosidase TM0752 {Thermotoga maritima [TaxId: 2336]}
hgvagvyevfekldldpeevdwqvagvnhgiwlnrfryrgedayplldewiekklpewep
knpwdtqmspaamdmykfygmlpigdtvrngswkyhynletkkkwfgkfggidneverpk
fheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeqhipfinaiannkrvrl
flnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikifylwprilrmewnle
ayisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryyke

SCOPe Domain Coordinates for d1vjta2:

Click to download the PDB-style file with coordinates for d1vjta2.
(The format of our PDB-style files is described here.)

Timeline for d1vjta2: